General Information

  • ID:  hor005297
  • Uniprot ID:  Q9TR93
  • Protein name:  Peptide YY
  • Gene name:  PYY
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPSKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
  • Length:  36
  • Propeptide:  YPSKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
  • Signal peptide:  NA
  • Modification:  T13 Phosphoserine;T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TR93-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9TR93-F1.pdbhor005297_AF2.pdbhor005297_ESM.pdb

Physical Information

Mass: 490915 Formula: C191H288N54O59
Absent amino acids: CFIMW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 12 Hydrophobic residues: 8
Hydrophobicity: -124.17 Boman Index: -10805
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 59.72
Instability Index: 8764.17 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  7984499
  • Title:  Characterization of two forms of peptide YY, PYY(1-36) and PYY(3-36), in the rabbit.